PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 172aa    MW: 19282.2 Da    PI: 4.7687
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26232.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.54.5e-1710623385
                -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
          B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85
                 ++l+ +d++g++W++++i+r++++r++lt+GW+ Fv a++L +gD+++F  +
  KHN26232.1 10 AQELIARDLHGNEWKFRHIFRGQPKRHLLTTGWSVFVTAKRLVVGDSMLFIWQ 62
                348999********************************************854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.884175IPR003340B3 DNA binding domain
SuperFamilySSF1019369.16E-20269IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-20363IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.005476IPR003340B3 DNA binding domain
PfamPF023626.1E-15762IPR003340B3 DNA binding domain
CDDcd100177.83E-141165No hitNo description
SuperFamilySSF537202.09E-1961149IPR016161Aldehyde/histidinol dehydrogenase
Gene3DG3DSA:3.40.309.102.8E-2164148IPR016163Aldehyde dehydrogenase, C-terminal
PfamPF001713.2E-1871150IPR015590Aldehyde dehydrogenase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016620Molecular Functionoxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MQDFSQQPPA QELIARDLHG NEWKFRHIFR GQPKRHLLTT GWSVFVTAKR LVVGDSMLFI  60
WQGGNILTYE SVLGSRENFV EPTIVEISLD APVVKEELFG PVLYVMKFQT LEEAIALNNS  120
VPQGLSISIF TQNLELYSSG SASSDTGMLT KLVIPETQVD MCPCVLQECL HP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4pxn_A5e-2662150378468Uncharacterized protein
4pxn_B5e-2662150378468Uncharacterized protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2507043e-88AY250704.1 Glycine max aldehyde dehydrogenase family 7 member A1 (TP55) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0B2R2Y41e-126A0A0B2R2Y4_GLYSO; Auxin response factor 17
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15884610
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.12e-35auxin response factor 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]